Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012306 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012306, RRID:AB_1854827
- Product name
- Anti-POSTN
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVID
RVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEA
LGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVAS
EALMKYHILNTLQCSESIMGGAVFETLEG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Calon A, Lonardo E, Berenguer-Llergo A, Espinet E, Hernando-Momblona X, Iglesias M, Sevillano M, Palomo-Ponce S, Tauriello D, Byrom D, Cortina C, Morral C, Barceló C, Tosi S, Riera A, Attolini C, Rossell D, Sancho E, Batlle E
Nature Genetics 2015 February;47(4):320-329
Nature Genetics 2015 February;47(4):320-329
Stromal gene expression defines poor-prognosis subtypes in colorectal cancer
Calon A, Lonardo E, Berenguer-Llergo A, Espinet E, Hernando-Momblona X, Iglesias M, Sevillano M, Palomo-Ponce S, Tauriello D, Byrom D, Cortina C, Morral C, Barceló C, Tosi S, Riera A, Attolini C, Rossell D, Sancho E, Batlle E
Nature Genetics 2015 February;47(4):320-329
Nature Genetics 2015 February;47(4):320-329
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Edlund K, Lindskog C, Saito A, Berglund A, Pontén F, Göransson-Kultima H, Isaksson A, Jirström K, Planck M, Johansson L, Lambe M, Holmberg L, Nyberg F, Ekman S, Bergqvist M, Landelius P, Lamberg K, Botling J, Östman A, Micke P
International Journal of Cancer 2012 November;131(10):2264-2273
International Journal of Cancer 2012 November;131(10):2264-2273
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skin and pancreas tissues using Anti-POSTN antibody. Corresponding POSTN RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
