HPA019041

ARMC9 antibody from Sigma-Aldrich
ARM, FLJ12584, KIAA1868, KU-MEL-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019041
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019041, RRID:AB_1845035
Product name
Anti-ARMC9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019041
Antibody type
Polyclonal
Antigen
LisH domain-containing protein ARMC9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKP
LCKTVGGSFRDSKSLTIQKDLVAAFDNGDQKVFFD
LWEEHISSSIRD
Storage
-20C
Provider Type Product Number
- No reagents -