HPA007301

CTTNBP2NL antibody from Sigma-Aldrich
DKFZp547A023
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007301
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007301, RRID:AB_1847693
Product name
Anti-CTTNBP2NL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007301
Antibody type
Polyclonal
Antigen
CTTNBP2 N-terminal-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVI
LDLEEERQRHAQDTAEGDDVTYMLEKERERLTQQL
EFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSSML
VLECKKATNKAAEEGQKAGELSLKLEKEKSRVSKL
EEELAAERKR
Storage
-20C
Provider Type Product Number
- No reagents -