HPA027895

NMUR1 antibody from Sigma-Aldrich
FM-3, GPC-R, GPR66, NMU1R
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027895
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027895, RRID:AB_10602713
Product name
Anti-NMUR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027895
Antibody type
Polyclonal
Antigen
neuromedin U receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFD
PEDLNLTDEALRLKYLGPQQTELFMP
Storage
-20C
Provider Type Product Number
- No reagents -