AV42668

ALPG antibody from MilliporeSigma / Merck KGaA
ALPPL2, GCAP
No application information provided.

Antibody data

Product number
AV42668
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV42668, RRID:AB_1844775
Product name
Anti-ALPPL2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV42668
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ALPPL2 with an internal ID of P24901
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAA
EALGAAKKLQPAQTA
Storage
-20C
Provider Type Product Number
- No reagents -