Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000248-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000248-M03, RRID:AB_529960
- Product name
- ALPI monoclonal antibody (M03), clone 3A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALPI.
- Antigen sequence
LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQV
PDSAATATAYLCGVKANFQTIGLSAAARFNQCNTT
RGNEVISVMNRAKQAGKSV- Isotype
- IgG
- Antibody clone number
- 3A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Development of a fluorescence-based assay for drug interactions with human Multidrug Resistance Related Protein (MRP2; ABCC2) in MDCKII-MRP2 membrane vesicles.
Lechner C, Reichel V, Moenning U, Reichel A, Fricker G
European journal of pharmaceutics and biopharmaceutics : official journal of Arbeitsgemeinschaft fur Pharmazeutische Verfahrenstechnik e.V 2010 Jun;75(2):284-90
European journal of pharmaceutics and biopharmaceutics : official journal of Arbeitsgemeinschaft fur Pharmazeutische Verfahrenstechnik e.V 2010 Jun;75(2):284-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALPI monoclonal antibody (M03), clone 3A8 Western Blot analysis of ALPI expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ALPI is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol