HPA019253

EIF4E2 antibody from Sigma-Aldrich
4EHP, EIF4EL3, IF4e
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019253
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019253, RRID:AB_1848092
Product name
Anti-EIF4E2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019253
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 4E type 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRR
TPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMV
RPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWII
RL
Storage
-20C
Provider Type Product Number
- No reagents -