HPA007329

AFAP1L1 antibody from Sigma-Aldrich
FLJ36748
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007329
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007329, RRID:AB_1844658
Product name
Anti-AFAP1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007329
Antibody type
Polyclonal
Antigen
Actin filament-associated protein 1-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDVETLTSIVSAGRNSFLYARSCQNQWPEPRVYDD
VPYEKMQDEEPERPTGAQVKRHASSCSEKSHRVDP
QVKVKRHASSANQYKYGKNRAEEDARRYLVEKEKL
EKEKETIRTELIALRQEKRELKEAIRSSPG
Storage
-20C
Provider Type Product Number
- No reagents -