Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN598037 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Thymosin beta 15a (TMSB15A) (AA 1-45) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic human Thymosin b15 (aa 1-45) KLH conjugated(MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS).
- Description
- Unpurified Serum
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- AA 1-45
- Vial size
- 20 μL
- Storage
- Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C.
- Handling
- Aliquot to Avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data