Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 298286 - Provider product page

- Provider
- United States Biological
- Product name
- Thymosin B15 (NB Thymosin beta, Thymosin-Like Protein 8, TMSB15A, TMSL8, TMSNB)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to aa1-45, MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS, of human Thymosin B15, KLH conjugated.
- Description
- Serum
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- Blue Ice
- Concentration
- Not determined
- Storage
- -20°C
No comments: Submit comment
No validations: Submit validation data