Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028670 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028670, RRID:AB_10601257
- Product name
- Anti-CHD1L
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQL
VNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTK
RKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CHD1L: a new candidate gene for congenital anomalies of the kidneys and urinary tract (CAKUT)
Brockschmidt A, Chung B, Weber S, Fischer D, Kolatsi-Joannou M, Christ L, Heimbach A, Shtiza D, Klaus G, Simonetti G, Konrad M, Winyard P, Haffner D, Schaefer F, Weber R
Nephrology Dialysis Transplantation 2012 May;27(6):2355-2364
Nephrology Dialysis Transplantation 2012 May;27(6):2355-2364
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-CHD1L antibody HPA028670 (A) shows similar pattern to independent antibody HPA027789 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and pancreas tissues using Anti-CHD1L antibody. Corresponding CHD1L RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, pancreas and testis using Anti-CHD1L antibody HPA028670 (A) shows similar protein distribution across tissues to independent antibody HPA027789 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-CHD1L antibody HPA028670.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-CHD1L antibody HPA028670.
- Sample type
- HUMAN