HPA007922

UBE2Z antibody from Atlas Antibodies
FLJ13855, USE1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007922
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007922, RRID:AB_1858551
Product name
Anti-UBE2Z
Provider product page
Atlas Antibodies - HPA007922
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNY
NECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSF
LEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDY
QSLLMRLGLIRQKVLERLHNENAEMDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -