Antibody data

Product number
ABIN486955
Provider
antibodies-online
Product name
anti-Gastrulation Brain Homeo Box 2 (GBX2) antibody
Provider product page
antibodies-online - ABIN486955
Antibody type
Polyclonal
Antigen
The immunogen for anti-GBX2 antibody: synthetic peptide directed towards the middle region of human GBX2
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
RGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNL
TGQAA HKEEDPGHAL
Vial size
50 µg
Provider Type Product Number
- No reagents -