HPA007226

CNST antibody from Atlas Antibodies
C1orf71, FLJ32001, PPP1R64

Antibody data

Product number
HPA007226
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007226, RRID:AB_2667782
Product name
Anti-CNST
Provider product page
Atlas Antibodies - HPA007226
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVE
QLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLER
LYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNS
EKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -