PAB20366

CNST antibody from Abnova Corporation
C1orf71, FLJ32001, PPP1R64

Antibody data

Product number
PAB20366
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20366, RRID:AB_10967280
Product name
C1orf71 polyclonal antibody
Provider product page
Abnova Corporation - PAB20366
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C1orf71.
Antigen sequence
PKEGGATTKESESKTCLGTESSKESQHTVEPLGSS
PCCHQMDVQTDSPSLSVTAGKDHMEELLCSAEATL
ALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTE
ACQDVARIEGIAEDPKVFLSSKSKTEPLISPGCDR
IPPAL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -