HPA007225

CNST antibody from Atlas Antibodies
C1orf71, FLJ32001, PPP1R64
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007225
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007225, RRID:AB_1848869
Product name
Anti-CNST
Provider product page
Atlas Antibodies - HPA007225
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PKEGGATTKESESKTCLGTESSKESQHTVEPLGSS
PCCHQMDVQTDSPSLSVTAGKDHMEELLCSAEATL
ALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTE
ACQDVARIEGIAEDPKVFLSSKSKTEPLISPGCDR
IPPAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -