HPA007225

CNST antibody from Sigma-Aldrich
C1orf71, FLJ32001, PPP1R64
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007225
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007225, RRID:AB_1848869
Product name
Anti-C1orf71 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007225
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf71 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKEGGATTKESESKTCLGTESSKESQHTVEPLGSS
PCCHQMDVQTDSPSLSVTAGKDHMEELLCSAEATL
ALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTE
ACQDVARIEGIAEDPKVFLSSKSKTEPLISPGCDR
IPPAL
Storage
-20C
Provider Type Product Number
- No reagents -