H00051313-B01P

GASK1B antibody from Abnova Corporation
C4orf18, DKFZp434L142, ENED, FAM198B, FLJ38155
No application information provided.

Antibody data

Product number
H00051313-B01P
Provider
Abnova Corporation
Product name
C4orf18 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051313-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C4orf18 protein.
Antigen sequence
MTCPDKPGQLINWFICSLCVPRVRKLWSSRRPRTR
RNLLLGTACAIYLGFLVSQVGRASLQHGQAAEKGP
HRSRDTAEPSFPEIPLDGTLAPPESQGNGSTLQPN
VVYITLRSKRSKPANIRGTVKPKRRKKHAVASAAP
GQEALVGPSLQPQEAAREADAVAPGYAQGANLVKI
GERPWRLVRGPGVRAGGPDFLQPSSRESNIRIYSE
SAPSWLSKDDIRRMRLLADSAVAGLRPVSSRSGAR
LLVLEGGAPGAVLRCGPSPCGLLKQPLDMSEVFAF
HLDRILGLNRTLPSVSRKAEFIQAAAAACLSMRLA
FFIFPAWEDMRVPGKCCIGHARLTWGTYQQLLKQK
CWQNGRVPKPESGCTEIHHHEWSKMALFDFLLQIY
NRLDTNCCGFRPRKEDACVQNGLRPKCDDQGSAAL
AHIIQRKHDPRHLVFIDNKSFFDRSEDNLNFKLLE
GIKEFPASAVSVLKSQHLRQKLLQSLFLDKVYWES
QGGRQGIEKLIDVIEHRAKILITYINAHGVKVLPM
NE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.