HPA007227
antibody from Atlas Antibodies
Targeting: GASK1B
C4orf18, DKFZp434L142, ENED, FAM198B, FLJ38155
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007227 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007227, RRID:AB_1847689
- Product name
- Anti-FAM198B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAA
EKGPHRSRDTAEPSFPEIPLDGTLAPPESQGNGST
LQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVA
SAAPGQEALVGPSLQPQEAAREADAVAPGYA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Lindskog C, Korsgren O, Pontén F, Eriksson J, Johansson L, Danielsson A
Journal of Proteomics 2012 May;75(9):2611-2620
Journal of Proteomics 2012 May;75(9):2611-2620
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and FAM198B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422154).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus, nucleoli fibrillar center & the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN