HPA026518

C1orf54 antibody from Sigma-Aldrich
FLJ23221
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026518
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026518, RRID:AB_1845647
Product name
Anti-C1orf54 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026518
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf54 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIF
ESEDRLNRLDKDITEAIETTISLETARADHPKPVT
VKPVTTE
Storage
-20C
Provider Type Product Number
- No reagents -