Antibody data

Product number
H00285671-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00285671-M05, RRID:AB_1137424
Product name
RNF180 monoclonal antibody (M05), clone 1C4
Provider product page
Abnova Corporation - H00285671-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RNF180.
Antigen sequence
MKRSKELITKNHSQEETSILRCWKCRKCIASSGCF
MEYLENQVIKDKDDSVDAQNICHVWHMNVEALPEW
ISCLIQKAQWTVGKLNCPFCGARLGGFNFV
Isotype
IgG
Antibody clone number
1C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -