HPA027226

PRPF3 antibody from Atlas Antibodies
hPrp3, Prp3, RP18, SNRNP90
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027226
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027226, RRID:AB_1855770
Product name
Anti-PRPF3
Provider product page
Atlas Antibodies - HPA027226
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQ
LNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQK
ELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDP
TK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -