Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009129-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009129-M01, RRID:AB_566105
- Product name
- PRPF3 monoclonal antibody (M01), clone 3H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PRPF3.
- Antigen sequence
EGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEES
DEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTE
NMAREHFKKHGAEHYWDLALSESVLESTD- Isotype
- IgG
- Antibody clone number
- 3H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PRPF mutations are associated with generalized defects in spliceosome formation and pre-mRNA splicing in patients with retinitis pigmentosa.
Tanackovic G, Ransijn A, Thibault P, Abou Elela S, Klinck R, Berson EL, Chabot B, Rivolta C
Human molecular genetics 2011 Jun 1;20(11):2116-30
Human molecular genetics 2011 Jun 1;20(11):2116-30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRPF3 monoclonal antibody (M01), clone 3H6 Western Blot analysis of PRPF3 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PRPF3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol