HPA026620

ANKMY1 antibody from MilliporeSigma / Merck KGaA
FLJ20499, ZMYND13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026620
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026620, RRID:AB_1844834
Product name
Anti-ANKMY1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026620
Antibody type
Polyclonal
Antigen
Ankyrin repeat and MYND domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSFMDTNLESLYYEVNVPSQGSYELRPPPAPLLLP
RVSGSHEGGHFQDTGQCGGSIDHRSSSLKGDSPLV
KGSLGHVESGLEDVLGNTDRGSLCSAETKFESNVC
VCDFSIELSQAMLERSAQSHSLLKMA
Storage
-20C
Provider Type Product Number
- No reagents -