Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311084 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GALNT10 antibody: synthetic peptide directed towards the N terminal of human GALNT10
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Zebrafish
- Host
- Rabbit
- Antigen sequence
VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRH
LSAGD VAVQKKLRSS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T10.
Cheng L, Tachibana K, Zhang Y, Guo Jm, Kahori Tachibana K, Kameyama A, Wang H, Hiruma T, Iwasaki H, Togayachi A, Kudo T, Narimatsu H
FEBS letters 2002 Nov 6;531(2):115-21
FEBS letters 2002 Nov 6;531(2):115-21
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting