HPA007525

GALNT10 antibody from Atlas Antibodies
GalNAc-T10

Antibody data

Product number
HPA007525
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007525, RRID:AB_1849443
Product name
Anti-GALNT10
Provider product page
Atlas Antibodies - HPA007525
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQ
RVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDK
ISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHN
EGWSSLLRTVHSVLNRS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.