ABIN1109547
antibody from antibodies-online
Targeting: ZC3H7B
DKFZp434K0920, FLJ13787, KIAA1031, RoXaN
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109547 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger CCCH-Type Containing 7B (ZC3H7B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZC3H7B antibody: synthetic peptide directed towards the N terminal of human ZC3H7B
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
YECSSRCSLALPHDESVTQLGQELAQKLGLRVRKA
YKRPQELETFSLLSN- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references RoXaN, a novel cellular protein containing TPR, LD, and zinc finger motifs, forms a ternary complex with eukaryotic initiation factor 4G and rotavirus NSP3.
Vitour D, Lindenbaum P, Vende P, Becker MM, Poncet D
Journal of virology 2004 Apr;78(8):3851-62
Journal of virology 2004 Apr;78(8):3851-62
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Liver; WB Suggested Anti-ZC3H7B Antibody Titration: 4ug/ml. Positive Control: Human Liver; ZC3H7B antibody - N-terminal region (AP42118PU-N) in Human Liver cells using Western Blot