HPA001784

ZC3H7B antibody from Sigma-Aldrich
DKFZp434K0920, FLJ13787, KIAA1031, RoXaN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001784
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001784, RRID:AB_1080637
Product name
Anti-ZC3H7B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001784
Antibody type
Polyclonal
Antigen
Zinc finger CCCH domain-containing protein 7B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAAS
VLDALDPPGPTLDPLDLLPYSETRLDALDSFGSTR
GSLDKPDSFMEETNSQDHRPPSGAQKPAPSPEPCM
PNTALLIKNPLAATHEFKQACQLCYPKTGPRAGDY
TYREGLEH
Storage
-20C
Provider Type Product Number
- No reagents -