HPA018142

SETDB1 antibody from Sigma-Aldrich
ESET, KG1T, KIAA0067, KMT1E, TDRD21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018142
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018142, RRID:AB_1856757
Product name
Anti-SETDB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018142
Antibody type
Polyclonal
Antigen
Histone-lysine N-methyltransferase SETDB1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDI
EDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWE
GTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTR
LEPMFSMKTSSASALEKKQGQLRTRPNMGAVRSKG
PVVQYTQD
Storage
-20C
Provider Type Product Number
- No reagents -