HPA021079

PASK antibody from Sigma-Aldrich
KIAA0135, PASKIN, STK37
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021079, RRID:AB_1854993
Product name
Anti-PASK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021079
Antibody type
Polyclonal
Antigen
PAS domain-containing serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSE
LRETPSSLAVGSDPDVGSLQEQGSCVLDDRELLLL
TGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEH
Storage
-20C
Provider Type Product Number
- No reagents -