HPA027262

CERS2 antibody from Atlas Antibodies

FLJ10243, LASS2, SP260

Western blot: Supportive data in Antibodypedia

Immunocytochemistry: Supportive data in Antibodypedia

Immunohistochemistry: Enhanced validation

Provider product page for HPA027262

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Western blot [2]
Immunocytochemistry [1]
Immunohistochemistry [6]

Submit

Validation data

Product number: HPA027262
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA027262, RRID:AB_1852717
Product name: Anti-CERS2
Provider product page: Atlas Antibodies - HPA027262
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPK QVEVELLSRQSGLSGRQVARWFRRRRNQDRPSLLK KFREA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows only weak cytoplasmic positivity in striated muscle fibers as expected.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA027262 antibody. Corresponding CERS2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more