HPA027262

CERS2 antibody from Atlas Antibodies
FLJ10243, LASS2, SP260
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027262
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027262, RRID:AB_1852717
Product name
Anti-CERS2
Provider product page
Atlas Antibodies - HPA027262
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPK
QVEVELLSRQSGLSGRQVARWFRRRRNQDRPSLLK
KFREA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -