H00029956-M01A

CERS2 antibody from Abnova Corporation
FLJ10243, LASS2, SP260
No application information provided.

Antibody data

Product number
H00029956-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029956-M01A, RRID:AB_1016829
Product name
LASS2 monoclonal antibody (M01A), clone 1A6
Provider product page
Abnova Corporation - H00029956-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LASS2.
Antigen sequence
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAK
ASDLYITLPLALLFLIVRYFFELYVATPLAALLNI
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSR
QSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQST
IPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYL
LESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLL
HIFWAYLILRMAHKFITGKLVEDERSDREETESSE
GEEAAAGGGAKSRPLANGHPILNNNHRKND
Isotype
IgM
Antibody clone number
1A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -