HPA027262

CERS2 antibody from Sigma-Aldrich
FLJ10243, LASS2, SP260
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027262
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027262, RRID:AB_1852717
Product name
Anti-LASS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027262
Antibody type
Polyclonal
Antigen
LAG1 longevity assurance homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPK
QVEVELLSRQSGLSGRQVARWFRRRRNQDRPSLLK
KFREA
Storage
-20C
Provider Type Product Number
- No reagents -