HPA023464

BNIPL antibody from Sigma-Aldrich
BNIPl-1, BNIPL-2, PP753
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023464
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023464, RRID:AB_1845409
Product name
Anti-BNIPL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023464
Antibody type
Polyclonal
Antigen
Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGTIQEAGKKTDVGVREIAEAPELGAALRHGELEL
KEEWQDEEFPRLLPEEAGTSEDPEDPKGDSQAAAG
T
Storage
-20C
Provider Type Product Number
- No reagents -