HPA008318

FAM110B antibody from Sigma-Aldrich
C8orf72, MGC39325
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008318, RRID:AB_1853892
Product name
Anti-FAM110B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008318
Antibody type
Polyclonal
Antigen
Protein FAM110B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVTSVKPLKAIPCSSSAPPLPPKPKIAAIASMKSP
EADPVEPACGVSRRPSLQRSKSDLSDRYFRVDADV
ERFFNYCGLDPEELENLGMENFARANSDIISLNFR
SASMISSDC
Storage
-20C
Provider Type Product Number
- No reagents -