Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487057 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-VPS72 antibody: synthetic peptide directed towards the N terminal of human VPS72
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
GGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEP
SSDGE AEEPRRKRRV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
Denoeud F, Kapranov P, Ucla C, Frankish A, Castelo R, Drenkow J, Lagarde J, Alioto T, Manzano C, Chrast J, Dike S, Wyss C, Henrichsen CN, Holroyd N, Dickson MC, Taylor R, Hance Z, Foissac S, Myers RM, Rogers J, Hubbard T, Harrow J, Guigó R, Gingeras TR, Antonarakis SE, Reymond A
Genome research 2007 Jun;17(6):746-59
Genome research 2007 Jun;17(6):746-59
No comments: Submit comment
No validations: Submit validation data