Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008320 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008320, RRID:AB_1848419
- Product name
- Anti-FAM98B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
STTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLK
MDLNSEQAEQLERINDALSCEYECRRRMLMKRLDV
TVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTI
TMAHLLAAREDLSKIIRTSSGTSREKTACAI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells
Pérez-González A, Pazo A, Navajas R, Ciordia S, Rodriguez-Frandsen A, Nieto A
PloS one 2014;9(3):e90957
PloS one 2014;9(3):e90957
Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
Popow J, Jurkin J, Schleiffer A, Martinez J
Nature 2014 Jul 3;511(7507):104-7
Nature 2014 Jul 3;511(7507):104-7
The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells
Jurkin J, Henkel T, Nielsen A, Minnich M, Popow J, Kaufmann T, Heindl K, Hoffmann T, Busslinger M, Martinez J
The EMBO Journal 2014 December;33(24):2922-2936
The EMBO Journal 2014 December;33(24):2922-2936
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-FAM98B antibody HPA008320 (A) shows similar pattern to independent antibody HPA008502 (B).
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and FAM98B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420899).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-FAM98B antibody HPA008320 (A) shows similar protein distribution across tissues to independent antibody HPA008502 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong membranous and nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-FAM98B antibody HPA008320.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-FAM98B antibody HPA008320.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-FAM98B antibody HPA008320.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-FAM98B antibody HPA008320.
- Sample type
- HUMAN
