Antibody data

Product number
HPA023948
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023948, RRID:AB_2671380
Product name
Anti-ZNF687
Provider product page
Atlas Antibodies - HPA023948
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKLSPATPTSEGPKVVSVQLGDGTRLKGTVLPVAT
IQNASTAMLMAASVARKAVVLPGGTATSPKMIAKN
VL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.