ABIN501818

ZNF687 antibody from antibodies-online
KIAA1441
Western blot
Data presented on provider website

Antibody data

Product number
ABIN501818
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 687 (ZNF687) (C-Term) antibody
Provider product page
antibodies-online - ABIN501818
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF687 antibody: synthetic peptide directed towards the C terminal of human ZNF687
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Rabbit
Host
Rabbit
Antigen sequence
DSPLPASGGPLTCKVCGKSCDSPLNLKTHFRTHGM
AFIRA RQGAVGDN
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.