HPA008322

ACSF3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008322
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008322, RRID:AB_1845294
Product name
Anti-ACSF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008322
Antibody type
Polyclonal
Antigen
Acyl-CoA synthetase family member 3, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATCVMMPEFSPQQVWEKFLSSETPRINVFMAVPTI
YTKLMEYYDRHFTQPHAQDFLRAVCEEKIRLMVSG
SAALPLPVLEKWKNITGHTLLERYGMTEIGMALSG
PLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSY
TIHA
Storage
-20C
Provider Type Product Number
- No reagents -