HPA006292

CELF3 antibody from Sigma-Aldrich
BRUNOL1, CAGH4, ERDA4, MGC57297, TNRC4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006292
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006292, RRID:AB_10602250
Product name
Anti-TNRC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006292
Antibody type
Polyclonal
Antigen
trinucleotide repeat containing 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVSAIPAALGVNGYSPVPTQPTGQPAPDALYPNGV
HPYPAQSPAAPVDPLQQAYAGMQHYTAAYPAAYSL
VAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQ
REGPDGCNIFIYHLPQEFTDSEILQMFV
Storage
-20C
Provider Type Product Number
- No reagents -