Antibody data

Product number
H00006097-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006097-M01, RRID:AB_1137426
Product name
RORC monoclonal antibody (M01), clone 1G7
Provider product page
Abnova Corporation - H00006097-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RORC.
Antigen sequence
FSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNL
ELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVE
RLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGL
S
Isotype
IgG
Antibody clone number
1G7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -