Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006282-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006282-M01, RRID:AB_626497
- Product name
- S100A11 monoclonal antibody (M01), clone 2F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant S100A11.
- Antigen sequence
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLS
KTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN
SDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT- Isotype
- IgG
- Antibody clone number
- 2F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue.
Li J, Riau AK, Setiawan M, Mehta JS, Ti SE, Tong L, Tan DT, Beuerman RW
Molecular vision 2011;17:2263-71
Molecular vision 2011;17:2263-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged S100A11 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to S100A11 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to S100A11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol