HPA008507

SVBP antibody from Atlas Antibodies
CCDC23, MGC45441
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008507
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008507, RRID:AB_2072066
Product name
Anti-SVBP
Provider product page
Atlas Antibodies - HPA008507
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQR
AEIYALNRVMTELEQQQFDEFCKQMQPPGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -