HPA008507

SVBP antibody from Sigma-Aldrich
CCDC23, MGC45441
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008507
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008507, RRID:AB_2072066
Product name
Anti-CCDC23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008507
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQR
AEIYALNRVMTELEQQQFDEFCKQMQPPGE
Storage
-20C
Provider Type Product Number
- No reagents -