HPA008325

DPY19L3 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008325
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008325, RRID:AB_1847853
Product name
Anti-DPY19L3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008325
Antibody type
Polyclonal
Antigen
Protein dpy-19 homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTVELMNWINSNTPRKAVFAGSMQLLAGVKLCTGR
TLTNHPHYEDSSLRERTRAVYQIYAKRAPEEVHAL
LRSFGTDYVILEDSICYERRHRRGCRLRDLLDIAN
GHMMDGPGENDPDLKPADHPRFCEEIKRNLP
Storage
-20C
Provider Type Product Number
- No reagents -