H00055228-B01P

PNMA8A antibody from Abnova Corporation
FLJ10781, KIAA1183L, PNMAL1
No application information provided.

Antibody data

Product number
H00055228-B01P
Provider
Abnova Corporation
Product name
PNMAL1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055228-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PNMAL1 protein.
Antigen sequence
MSKTMAMNLLEDWCRGMEVDIHRSLLVTGIPEDCG
QAEIEETLNGVLSPLGPYRVLNKIFVREENVKAAL
IEVGEGVNLSTIPREFPGRGGVWRVVCRDPTQDAE
FLKNLNEFLDAEGRTWEDVVRLLQLNHPTLSQNQH
QPPENWAEALGVLLGAVVQIIFCMDAEIRSREEAR
AQEAAEFEEMAAWALAAGRKVKKEPGLAAEVGSAL
KAETPNNWNATEDQHEPTKPLVRRAGAKSRSRRKK
QKKNSRQEAVPWKKPKGINSNSTANLEDPEVGDAE
SMAISEPIKGSRKPCVNKEELALKKPMAKCAWKGP
REPPQDARAEAESPGGASESDQDGGHESPPKKKAV
AWVSAKNPAPMRKKKKVSLGPVSYVLVDSEDGRKK
PVMPKKGPGSRREASDQKAPRGQQPAEATASTSRG
PKAKPEGSPRRATNESRKV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -