PAB20641

PNMA8A antibody from Abnova Corporation
FLJ10781, KIAA1183L, PNMAL1

Antibody data

Product number
PAB20641
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20641, RRID:AB_10964231
Product name
PNMAL1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20641
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant PNMAL1.
Antigen sequence
KPKGINSNSTANLEDPEVGDAESMAISEPIKGSRK
PCVNKEELALKKPMAKCAWKGPREPPQDARAEAES
PGGASESDQDGGHESPPKKKAVAWVSAKNPAPMRK
KKKVSLGPVSYVLVDSEDGRKKPVMP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -