Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405992 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kelch Domain Containing 8B (KLHDC8B) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KLHDC8B antibody: synthetic peptide directed towards the middle region of human KLHDC8B
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFD
LEHGS WTKLPRSLRM- Vial size
- 50 µg
Submitted references Large-scale cDNA transfection screening for genes related to cancer development and progression.
Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J
Proceedings of the National Academy of Sciences of the United States of America 2004 Nov 2;101(44):15724-9
Proceedings of the National Academy of Sciences of the United States of America 2004 Nov 2;101(44):15724-9
No comments: Submit comment
No validations: Submit validation data