HPA008463

KLHDC8B antibody from MilliporeSigma / Merck KGaA
MGC35097
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008463
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008463, RRID:AB_1852563
Product name
Anti-KLHDC8B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008463
Antibody type
Polyclonal
Antigen
Kelch domain-containing protein 8B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHT
WLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSP
VAAVEAFLMDEGRWERRATLPQAAMGVATVERDGM
VYALG
Storage
-20C
Provider Type Product Number
- No reagents -